Placeholder image of a protein
Icon representing a puzzle

2300: Electron Density Reconstruction 39

Closed since about 3 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
May 08, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
GSHMLPDSDVKQALQAIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQLRGMLEDYAR

Top groups


  1. Avatar for Go Science 100 pts. 15,669
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 65 pts. 15,665
  3. Avatar for Marvin's bunch 3. Marvin's bunch 41 pts. 15,652
  4. Avatar for Contenders 4. Contenders 24 pts. 15,649
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 14 pts. 15,627
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 7 pts. 15,543
  7. Avatar for Australia 7. Australia 4 pts. 15,401
  8. Avatar for BOINC@Poland 8. BOINC@Poland 2 pts. 15,343
  9. Avatar for VeFold 9. VeFold 1 pt. 15,223
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 1 pt. 15,118

  1. Avatar for abiogenesis 51. abiogenesis Lv 1 1 pt. 15,137
  2. Avatar for izzgood 52. izzgood Lv 1 1 pt. 15,118
  3. Avatar for Arne Heessels 53. Arne Heessels Lv 1 1 pt. 15,094
  4. Avatar for rosie4loop 54. rosie4loop Lv 1 1 pt. 15,088
  5. Avatar for carxo 55. carxo Lv 1 1 pt. 15,074
  6. Avatar for DScott 56. DScott Lv 1 1 pt. 15,073
  7. Avatar for Merf 57. Merf Lv 1 1 pt. 15,073
  8. Avatar for Dr.Sillem 58. Dr.Sillem Lv 1 1 pt. 15,064
  9. Avatar for alyssa_d_V2.0 59. alyssa_d_V2.0 Lv 1 1 pt. 15,063
  10. Avatar for rinze 60. rinze Lv 1 1 pt. 15,004

Comments