Icon representing a puzzle

2299: Revisiting Puzzle 77: Copper Chaperone

Closed since almost 3 years ago

Novice Overall Prediction

Summary


Created
May 10, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups


  1. Avatar for VeFold 11. VeFold 1 pt. 9,259
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 9,255
  3. Avatar for SHELL 13. SHELL 1 pt. 8,463

  1. Avatar for Sandrix72 11. Sandrix72 Lv 1 52 pts. 10,077
  2. Avatar for Bletchley Park 12. Bletchley Park Lv 1 49 pts. 10,037
  3. Avatar for Flagg65a 13. Flagg65a Lv 1 45 pts. 10,025
  4. Avatar for WBarme1234 14. WBarme1234 Lv 1 42 pts. 10,000
  5. Avatar for akaaka 15. akaaka Lv 1 39 pts. 9,996
  6. Avatar for Galaxie 16. Galaxie Lv 1 36 pts. 9,978
  7. Avatar for silent gene 17. silent gene Lv 1 34 pts. 9,965
  8. Avatar for g_b 18. g_b Lv 1 31 pts. 9,927
  9. Avatar for christioanchauvin 19. christioanchauvin Lv 1 29 pts. 9,917
  10. Avatar for Bruno Kestemont 20. Bruno Kestemont Lv 1 27 pts. 9,889

Comments