Icon representing a puzzle

2299: Revisiting Puzzle 77: Copper Chaperone

Closed since almost 3 years ago

Novice Overall Prediction

Summary


Created
May 10, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups


  1. Avatar for VeFold 11. VeFold 1 pt. 9,259
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 9,255
  3. Avatar for SHELL 13. SHELL 1 pt. 8,463

  1. Avatar for roarshock 21. roarshock Lv 1 25 pts. 9,880
  2. Avatar for gmn 22. gmn Lv 1 23 pts. 9,861
  3. Avatar for fpc 23. fpc Lv 1 21 pts. 9,847
  4. Avatar for hansvandenhof 24. hansvandenhof Lv 1 19 pts. 9,831
  5. Avatar for BackBuffer 25. BackBuffer Lv 1 18 pts. 9,824
  6. Avatar for BootsMcGraw 26. BootsMcGraw Lv 1 16 pts. 9,821
  7. Avatar for Steven Pletsch 27. Steven Pletsch Lv 1 15 pts. 9,816
  8. Avatar for AlphaFold2 28. AlphaFold2 Lv 1 14 pts. 9,804
  9. Avatar for Vinara 29. Vinara Lv 1 12 pts. 9,746
  10. Avatar for alcor29 30. alcor29 Lv 1 11 pts. 9,739

Comments