Icon representing a puzzle

2299: Revisiting Puzzle 77: Copper Chaperone

Closed since almost 3 years ago

Novice Overall Prediction

Summary

Created
May 10, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups

  1. Avatar for VeFold 11. VeFold 1 pt. 9,259
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 9,255
  3. Avatar for SHELL 13. SHELL 1 pt. 8,463
  1. Avatar for ShadowTactics 31. ShadowTactics Lv 1 10 pts. 9,722
  2. Avatar for Hillbillie 32. Hillbillie Lv 1 9 pts. 9,716
  3. Avatar for AlkiP0Ps 33. AlkiP0Ps Lv 1 9 pts. 9,709
  4. Avatar for Arne Heessels 34. Arne Heessels Lv 1 8 pts. 9,687
  5. Avatar for NPrincipi 35. NPrincipi Lv 1 7 pts. 9,673
  6. Avatar for rosie4loop 36. rosie4loop Lv 1 6 pts. 9,654
  7. Avatar for Altercomp 37. Altercomp Lv 1 6 pts. 9,651
  8. Avatar for hada 38. hada Lv 1 5 pts. 9,630
  9. Avatar for jausmh 39. jausmh Lv 1 5 pts. 9,541
  10. Avatar for maithra 40. maithra Lv 1 4 pts. 9,533

Comments