Icon representing a puzzle

2299: Revisiting Puzzle 77: Copper Chaperone

Closed since almost 3 years ago

Novice Overall Prediction

Summary


Created
May 10, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups


  1. Avatar for VeFold 11. VeFold 1 pt. 9,259
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 9,255
  3. Avatar for SHELL 13. SHELL 1 pt. 8,463

  1. Avatar for Wanderer09 41. Wanderer09 Lv 1 4 pts. 9,526
  2. Avatar for SemperRabbit 42. SemperRabbit Lv 1 3 pts. 9,497
  3. Avatar for heather-1 43. heather-1 Lv 1 3 pts. 9,492
  4. Avatar for ucad 44. ucad Lv 1 3 pts. 9,478
  5. Avatar for ProfVince 45. ProfVince Lv 1 2 pts. 9,464
  6. Avatar for Dr.Sillem 46. Dr.Sillem Lv 1 2 pts. 9,424
  7. Avatar for RichGuilmain 47. RichGuilmain Lv 1 2 pts. 9,396
  8. Avatar for zbp 48. zbp Lv 1 2 pts. 9,375
  9. Avatar for georg137 49. georg137 Lv 1 2 pts. 9,366
  10. Avatar for phi16 50. phi16 Lv 1 1 pt. 9,352

Comments