Icon representing a puzzle

2299: Revisiting Puzzle 77: Copper Chaperone

Closed since almost 3 years ago

Novice Overall Prediction

Summary


Created
May 10, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups


  1. Avatar for VeFold 11. VeFold 1 pt. 9,259
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 9,255
  3. Avatar for SHELL 13. SHELL 1 pt. 8,463

  1. Avatar for Wiz kid 51. Wiz kid Lv 1 1 pt. 9,345
  2. Avatar for pfirth 52. pfirth Lv 1 1 pt. 9,321
  3. Avatar for DScott 53. DScott Lv 1 1 pt. 9,293
  4. Avatar for alyssa_d_V2.0 54. alyssa_d_V2.0 Lv 1 1 pt. 9,271
  5. Avatar for carxo 55. carxo Lv 1 1 pt. 9,259
  6. Avatar for izzgood 56. izzgood Lv 1 1 pt. 9,255
  7. Avatar for pizpot 57. pizpot Lv 1 1 pt. 9,248
  8. Avatar for InfoManiac742 58. InfoManiac742 Lv 1 1 pt. 9,196
  9. Avatar for abiogenesis 59. abiogenesis Lv 1 1 pt. 9,178
  10. Avatar for kitsoune 60. kitsoune Lv 1 1 pt. 9,098

Comments