Icon representing a puzzle

2299: Revisiting Puzzle 77: Copper Chaperone

Closed since almost 3 years ago

Novice Overall Prediction

Summary

Created
May 10, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,381
  2. Avatar for Go Science 2. Go Science 65 pts. 10,165
  3. Avatar for Contenders 3. Contenders 41 pts. 10,120
  4. Avatar for FamilyBarmettler 4. FamilyBarmettler 24 pts. 10,000
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 14 pts. 9,917
  6. Avatar for Marvin's bunch 6. Marvin's bunch 7 pts. 9,847
  7. Avatar for AlphaFold 7. AlphaFold 4 pts. 9,804
  8. Avatar for BOINC@Poland 8. BOINC@Poland 2 pts. 9,722
  9. Avatar for Australia 9. Australia 1 pt. 9,709
  10. Avatar for Trinity Biology 10. Trinity Biology 1 pt. 9,271
  1. Avatar for Oransche 61. Oransche Lv 1 1 pt. 9,036
  2. Avatar for Trajan464 62. Trajan464 Lv 1 1 pt. 9,027
  3. Avatar for Merf 63. Merf Lv 1 1 pt. 9,021
  4. Avatar for JJ38000 64. JJ38000 Lv 1 1 pt. 8,986
  5. Avatar for rinze 65. rinze Lv 1 1 pt. 8,864
  6. Avatar for froschi2 66. froschi2 Lv 1 1 pt. 8,833
  7. Avatar for WhiteOwl000 67. WhiteOwl000 Lv 1 1 pt. 8,820
  8. Avatar for Mohoernchen 68. Mohoernchen Lv 1 1 pt. 8,767
  9. Avatar for Dorane 69. Dorane Lv 1 1 pt. 8,726
  10. Avatar for pruneau_44 70. pruneau_44 Lv 1 1 pt. 8,664

Comments