Icon representing a puzzle

2299: Revisiting Puzzle 77: Copper Chaperone

Closed since almost 3 years ago

Novice Overall Prediction

Summary

Created
May 10, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,381
  2. Avatar for Go Science 2. Go Science 65 pts. 10,165
  3. Avatar for Contenders 3. Contenders 41 pts. 10,120
  4. Avatar for FamilyBarmettler 4. FamilyBarmettler 24 pts. 10,000
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 14 pts. 9,917
  6. Avatar for Marvin's bunch 6. Marvin's bunch 7 pts. 9,847
  7. Avatar for AlphaFold 7. AlphaFold 4 pts. 9,804
  8. Avatar for BOINC@Poland 8. BOINC@Poland 2 pts. 9,722
  9. Avatar for Australia 9. Australia 1 pt. 9,709
  10. Avatar for Trinity Biology 10. Trinity Biology 1 pt. 9,271
  1. Avatar for Deleted player 71. Deleted player 1 pt. 8,583
  2. Avatar for FwishCakes 72. FwishCakes Lv 1 1 pt. 8,556
  3. Avatar for U202143311 73. U202143311 Lv 1 1 pt. 8,463
  4. Avatar for ennimoye5853 74. ennimoye5853 Lv 1 1 pt. 8,461
  5. Avatar for wncrq3ytqo 75. wncrq3ytqo Lv 1 1 pt. 8,446
  6. Avatar for Sammy3c2b1a0 76. Sammy3c2b1a0 Lv 1 1 pt. 8,431
  7. Avatar for illex 77. illex Lv 1 1 pt. 8,378
  8. Avatar for Swapper242 78. Swapper242 Lv 1 1 pt. 8,274
  9. Avatar for KnaveErrant 79. KnaveErrant Lv 1 1 pt. 7,919
  10. Avatar for NAUL 80. NAUL Lv 1 1 pt. 6,482

Comments