Beginner Puzzle: Staphylococcus Aureus Electron Density
Closed since almost 3 years ago
BeginnerSummary
- Created
- May 10, 2023
- Expires
- Max points
- 100
In electron density puzzles, we give you some experimental data to help you find the correct fold. This data takes the form of an electron density, and appears in game as a guide. You can adjust the guide visualization from the Electron Density panel. This is a Beginner puzzle for new players that have joined Foldit in the last 6 months.
- Sequence
- MEYQLQQLASLTLVGIKETYENGRQAQQHIAGFWQRCYQEGVIADLQLKNNGDLAGILGLCIPELDGKMSYMIAVTGDNSADIAKYDVITLASSKYMVFEAQGAVPKAVQQKMEEVHHYIHQYQANTVKSAPFFELYQDGDTTSEKYITEIWMPVKG