Icon representing a puzzle

Beginner Puzzle: Staphylococcus Aureus Electron Density

Closed since almost 3 years ago

Beginner Beginner Beginner Beginner Beginner Beginner

Summary


Created
May 10, 2023
Expires
Max points
100
Description

In electron density puzzles, we give you some experimental data to help you find the correct fold. This data takes the form of an electron density, and appears in game as a guide. You can adjust the guide visualization from the Electron Density panel. This is a Beginner puzzle for new players that have joined Foldit in the last 6 months.

Sequence
MEYQLQQLASLTLVGIKETYENGRQAQQHIAGFWQRCYQEGVIADLQLKNNGDLAGILGLCIPELDGKMSYMIAVTGDNSADIAKYDVITLASSKYMVFEAQGAVPKAVQQKMEEVHHYIHQYQANTVKSAPFFELYQDGDTTSEKYITEIWMPVKG

Top groups


  1. Avatar for Go Science 100 pts. 14,084
  2. Avatar for SHELL 2. SHELL 4 pts. 13,772
  3. Avatar for CH4110 Fold it! 3. CH4110 Fold it! 1 pt. 13,090

  1. Avatar for rosie4loop
    1. rosie4loop Lv 1
    100 pts. 15,283
  2. Avatar for Deleted player 2. Deleted player 82 pts. 15,231
  3. Avatar for ricemilkk_ 3. ricemilkk_ Lv 1 66 pts. 14,418
  4. Avatar for davitzeiro42 4. davitzeiro42 Lv 1 53 pts. 14,275
  5. Avatar for EtherealSun 5. EtherealSun Lv 1 42 pts. 14,223
  6. Avatar for karl07 6. karl07 Lv 1 33 pts. 14,219
  7. Avatar for chaperone 7. chaperone Lv 1 26 pts. 14,206
  8. Avatar for ml4268 8. ml4268 Lv 1 20 pts. 14,161
  9. Avatar for Anago_pie 9. Anago_pie Lv 1 15 pts. 14,144
  10. Avatar for PankreasCupang 10. PankreasCupang Lv 1 11 pts. 14,105

Comments