Placeholder image of a protein
Icon representing a puzzle

2303: Electron Density Reconstruction 40

Closed since almost 3 years ago

Novice Overall Prediction Electron Density

Summary

Created
May 15, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. The individual chains in this protein have the same sequence.

Sequence
RMKQLEDKVEELLSKAYHLENEVARLKKLVGER

Top groups

  1. Avatar for Gargleblasters 11. Gargleblasters 1 pt. 23,066
  2. Avatar for SHELL 12. SHELL 1 pt. 22,985
  3. Avatar for AlphaFold 13. AlphaFold 1 pt. 22,984
  4. Avatar for Andrew's Foldit group 14. Andrew's Foldit group 1 pt. 22,929
  5. Avatar for JAWS PLAYERS 15. JAWS PLAYERS 1 pt. 22,601
  1. Avatar for RichGuilmain 11. RichGuilmain Lv 1 53 pts. 23,511
  2. Avatar for BackBuffer 12. BackBuffer Lv 1 49 pts. 23,507
  3. Avatar for dcrwheeler 13. dcrwheeler Lv 1 46 pts. 23,505
  4. Avatar for guineapig 14. guineapig Lv 1 43 pts. 23,504
  5. Avatar for blazegeek 15. blazegeek Lv 1 40 pts. 23,502
  6. Avatar for grogar7 16. grogar7 Lv 1 37 pts. 23,500
  7. Avatar for fpc 17. fpc Lv 1 34 pts. 23,499
  8. Avatar for Wanderer09 18. Wanderer09 Lv 1 32 pts. 23,496
  9. Avatar for Bletchley Park 19. Bletchley Park Lv 1 29 pts. 23,488
  10. Avatar for silent gene 20. silent gene Lv 1 27 pts. 23,483

Comments

LociOiling Lv 1

This one is a good match for PDB 1RB4 and several others, but the PDB entries seem to missing the last two residues ("ER") we see in this puzzle.

WBarme1234 Lv 1

2 equal helics Only +3rd helic missing 2residues at beginning of sequence
rmkqledkveellskayhlenevarlkklvg
rmkqledkveellskayhlenevarlkklvg
__kqledkveellskayhlenevarlkklvg
LHHHHHHHHHHHHHHHHHHHHHHHHHHHHHL
LHHHHHHHHHHHHHHHHHHHHHHHHHHHHHL
__LHHHHHHHHHHHHHHHHHHHHHHHHHHHL