Placeholder image of a protein
Icon representing a puzzle

2303: Electron Density Reconstruction 40

Closed since almost 3 years ago

Novice Overall Prediction Electron Density

Summary


Created
May 15, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. The individual chains in this protein have the same sequence.

Sequence
RMKQLEDKVEELLSKAYHLENEVARLKKLVGER

Top groups


  1. Avatar for Gargleblasters 11. Gargleblasters 1 pt. 23,066
  2. Avatar for SHELL 12. SHELL 1 pt. 22,985
  3. Avatar for AlphaFold 13. AlphaFold 1 pt. 22,984
  4. Avatar for Andrew's Foldit group 14. Andrew's Foldit group 1 pt. 22,929
  5. Avatar for JAWS PLAYERS 15. JAWS PLAYERS 1 pt. 22,601

  1. Avatar for 9999MATT 41. 9999MATT Lv 1 4 pts. 23,269
  2. Avatar for Cirraman 42. Cirraman Lv 1 4 pts. 23,236
  3. Avatar for hada 43. hada Lv 1 3 pts. 23,236
  4. Avatar for BlueEqualsRed 44. BlueEqualsRed Lv 1 3 pts. 23,227
  5. Avatar for ProfVince 45. ProfVince Lv 1 3 pts. 23,225
  6. Avatar for izzgood 46. izzgood Lv 1 2 pts. 23,222
  7. Avatar for rosie4loop 47. rosie4loop Lv 1 2 pts. 23,216
  8. Avatar for Oransche 48. Oransche Lv 1 2 pts. 23,201
  9. Avatar for jausmh 49. jausmh Lv 1 2 pts. 23,174
  10. Avatar for fiendish_ghoul 50. fiendish_ghoul Lv 1 2 pts. 23,147

Comments


LociOiling Lv 1

This one is a good match for PDB 1RB4 and several others, but the PDB entries seem to missing the last two residues ("ER") we see in this puzzle.

WBarme1234 Lv 1

2 equal helics Only +3rd helic missing 2residues at beginning of sequence
rmkqledkveellskayhlenevarlkklvg
rmkqledkveellskayhlenevarlkklvg
__kqledkveellskayhlenevarlkklvg
LHHHHHHHHHHHHHHHHHHHHHHHHHHHHHL
LHHHHHHHHHHHHHHHHHHHHHHHHHHHHHL
__LHHHHHHHHHHHHHHHHHHHHHHHHHHHL