Icon representing a puzzle

2305: Revisiting Puzzle 80: Calcium Channel Blocker

Closed since almost 3 years ago

Novice Overall Prediction

Summary

Created
May 24, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is found in green mamba venom, and blocks the flow of calcium ions that normally depolarize the muscle cell to induce muscle contraction. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK

Top groups

  1. Avatar for VeFold 11. VeFold 1 pt. 8,729
  2. Avatar for Gargleblasters 12. Gargleblasters 1 pt. 8,111
  3. Avatar for SHELL 13. SHELL 1 pt. 7,761
  4. Avatar for Andrew's Foldit group 14. Andrew's Foldit group 1 pt. 7,760
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 10,368
  2. Avatar for Sandrix72 2. Sandrix72 Lv 1 95 pts. 10,160
  3. Avatar for dcrwheeler 3. dcrwheeler Lv 1 90 pts. 10,127
  4. Avatar for BackBuffer 4. BackBuffer Lv 1 85 pts. 10,096
  5. Avatar for WBarme1234 5. WBarme1234 Lv 1 80 pts. 10,082
  6. Avatar for Punzi Baker 3 6. Punzi Baker 3 Lv 1 75 pts. 10,066
  7. Avatar for Idiotboy 7. Idiotboy Lv 1 71 pts. 10,055
  8. Avatar for Bruno Kestemont 8. Bruno Kestemont Lv 1 67 pts. 10,015
  9. Avatar for MicElephant 9. MicElephant Lv 1 63 pts. 10,014
  10. Avatar for guineapig 10. guineapig Lv 1 59 pts. 10,014

Comments