Icon representing a puzzle

2305: Revisiting Puzzle 80: Calcium Channel Blocker

Closed since almost 3 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
May 24, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is found in green mamba venom, and blocks the flow of calcium ions that normally depolarize the muscle cell to induce muscle contraction. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,368
  2. Avatar for Go Science 2. Go Science 68 pts. 10,160
  3. Avatar for FamilyBarmettler 3. FamilyBarmettler 44 pts. 10,082
  4. Avatar for Contenders 4. Contenders 27 pts. 10,014
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 16 pts. 9,926
  6. Avatar for Marvin's bunch 6. Marvin's bunch 9 pts. 9,846
  7. Avatar for Australia 7. Australia 5 pts. 9,792
  8. Avatar for Trinity Biology 8. Trinity Biology 3 pts. 8,835
  9. Avatar for AlphaFold 9. AlphaFold 1 pt. 8,802
  10. Avatar for :) 10. :) 1 pt. 8,769

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 10,368
  2. Avatar for Sandrix72 2. Sandrix72 Lv 1 95 pts. 10,160
  3. Avatar for dcrwheeler 3. dcrwheeler Lv 1 90 pts. 10,127
  4. Avatar for BackBuffer 4. BackBuffer Lv 1 85 pts. 10,096
  5. Avatar for WBarme1234 5. WBarme1234 Lv 1 80 pts. 10,082
  6. Avatar for Punzi Baker 3 6. Punzi Baker 3 Lv 1 75 pts. 10,066
  7. Avatar for Idiotboy 7. Idiotboy Lv 1 71 pts. 10,055
  8. Avatar for Bruno Kestemont 8. Bruno Kestemont Lv 1 67 pts. 10,015
  9. Avatar for MicElephant 9. MicElephant Lv 1 63 pts. 10,014
  10. Avatar for guineapig 10. guineapig Lv 1 59 pts. 10,014

Comments