Icon representing a puzzle

2305: Revisiting Puzzle 80: Calcium Channel Blocker

Closed since almost 3 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
May 24, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is found in green mamba venom, and blocks the flow of calcium ions that normally depolarize the muscle cell to induce muscle contraction. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,368
  2. Avatar for Go Science 2. Go Science 68 pts. 10,160
  3. Avatar for FamilyBarmettler 3. FamilyBarmettler 44 pts. 10,082
  4. Avatar for Contenders 4. Contenders 27 pts. 10,014
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 16 pts. 9,926
  6. Avatar for Marvin's bunch 6. Marvin's bunch 9 pts. 9,846
  7. Avatar for Australia 7. Australia 5 pts. 9,792
  8. Avatar for Trinity Biology 8. Trinity Biology 3 pts. 8,835
  9. Avatar for AlphaFold 9. AlphaFold 1 pt. 8,802
  10. Avatar for :) 10. :) 1 pt. 8,769

  1. Avatar for Galaxie 11. Galaxie Lv 1 56 pts. 9,987
  2. Avatar for grogar7 12. grogar7 Lv 1 52 pts. 9,984
  3. Avatar for NinjaGreg 13. NinjaGreg Lv 1 49 pts. 9,970
  4. Avatar for sallallami 14. sallallami Lv 1 46 pts. 9,960
  5. Avatar for gmn 15. gmn Lv 1 43 pts. 9,945
  6. Avatar for akaaka 16. akaaka Lv 1 40 pts. 9,943
  7. Avatar for Bletchley Park 17. Bletchley Park Lv 1 38 pts. 9,939
  8. Avatar for g_b 18. g_b Lv 1 35 pts. 9,932
  9. Avatar for blazegeek 19. blazegeek Lv 1 33 pts. 9,931
  10. Avatar for christioanchauvin 20. christioanchauvin Lv 1 31 pts. 9,926

Comments