Icon representing a puzzle

2305: Revisiting Puzzle 80: Calcium Channel Blocker

Closed since almost 3 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
May 24, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is found in green mamba venom, and blocks the flow of calcium ions that normally depolarize the muscle cell to induce muscle contraction. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,368
  2. Avatar for Go Science 2. Go Science 68 pts. 10,160
  3. Avatar for FamilyBarmettler 3. FamilyBarmettler 44 pts. 10,082
  4. Avatar for Contenders 4. Contenders 27 pts. 10,014
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 16 pts. 9,926
  6. Avatar for Marvin's bunch 6. Marvin's bunch 9 pts. 9,846
  7. Avatar for Australia 7. Australia 5 pts. 9,792
  8. Avatar for Trinity Biology 8. Trinity Biology 3 pts. 8,835
  9. Avatar for AlphaFold 9. AlphaFold 1 pt. 8,802
  10. Avatar for :) 10. :) 1 pt. 8,769

  1. Avatar for Flagg65a 21. Flagg65a Lv 1 29 pts. 9,852
  2. Avatar for fpc 22. fpc Lv 1 27 pts. 9,846
  3. Avatar for silent gene 23. silent gene Lv 1 25 pts. 9,820
  4. Avatar for Hillbillie 24. Hillbillie Lv 1 23 pts. 9,798
  5. Avatar for AlkiP0Ps 25. AlkiP0Ps Lv 1 21 pts. 9,792
  6. Avatar for drumpeter18yrs9yrs 26. drumpeter18yrs9yrs Lv 1 20 pts. 9,768
  7. Avatar for alcor29 27. alcor29 Lv 1 18 pts. 9,697
  8. Avatar for roarshock 28. roarshock Lv 1 17 pts. 9,654
  9. Avatar for BootsMcGraw 29. BootsMcGraw Lv 1 16 pts. 9,650
  10. Avatar for rosie4loop 30. rosie4loop Lv 1 14 pts. 9,578

Comments