Icon representing a puzzle

2305: Revisiting Puzzle 80: Calcium Channel Blocker

Closed since almost 3 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
May 24, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is found in green mamba venom, and blocks the flow of calcium ions that normally depolarize the muscle cell to induce muscle contraction. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,368
  2. Avatar for Go Science 2. Go Science 68 pts. 10,160
  3. Avatar for FamilyBarmettler 3. FamilyBarmettler 44 pts. 10,082
  4. Avatar for Contenders 4. Contenders 27 pts. 10,014
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 16 pts. 9,926
  6. Avatar for Marvin's bunch 6. Marvin's bunch 9 pts. 9,846
  7. Avatar for Australia 7. Australia 5 pts. 9,792
  8. Avatar for Trinity Biology 8. Trinity Biology 3 pts. 8,835
  9. Avatar for AlphaFold 9. AlphaFold 1 pt. 8,802
  10. Avatar for :) 10. :) 1 pt. 8,769

  1. Avatar for georg137 31. georg137 Lv 1 13 pts. 9,570
  2. Avatar for equilibria 32. equilibria Lv 1 12 pts. 9,566
  3. Avatar for ProfVince 33. ProfVince Lv 1 11 pts. 9,556
  4. Avatar for Oransche 34. Oransche Lv 1 10 pts. 9,550
  5. Avatar for heather-1 35. heather-1 Lv 1 10 pts. 9,454
  6. Avatar for Altercomp 36. Altercomp Lv 1 9 pts. 9,395
  7. Avatar for drjr 37. drjr Lv 1 8 pts. 9,349
  8. Avatar for Crossed Sticks 38. Crossed Sticks Lv 1 7 pts. 9,252
  9. Avatar for Wanderer09 39. Wanderer09 Lv 1 7 pts. 9,249
  10. Avatar for hada 40. hada Lv 1 6 pts. 9,143

Comments