Icon representing a puzzle

2305: Revisiting Puzzle 80: Calcium Channel Blocker

Closed since almost 3 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
May 24, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is found in green mamba venom, and blocks the flow of calcium ions that normally depolarize the muscle cell to induce muscle contraction. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,368
  2. Avatar for Go Science 2. Go Science 68 pts. 10,160
  3. Avatar for FamilyBarmettler 3. FamilyBarmettler 44 pts. 10,082
  4. Avatar for Contenders 4. Contenders 27 pts. 10,014
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 16 pts. 9,926
  6. Avatar for Marvin's bunch 6. Marvin's bunch 9 pts. 9,846
  7. Avatar for Australia 7. Australia 5 pts. 9,792
  8. Avatar for Trinity Biology 8. Trinity Biology 3 pts. 8,835
  9. Avatar for AlphaFold 9. AlphaFold 1 pt. 8,802
  10. Avatar for :) 10. :) 1 pt. 8,769

  1. Avatar for carxo 51. carxo Lv 1 2 pts. 8,729
  2. Avatar for abiogenesis 52. abiogenesis Lv 1 2 pts. 8,678
  3. Avatar for Trajan464 53. Trajan464 Lv 1 2 pts. 8,653
  4. Avatar for toshiue 54. toshiue Lv 1 2 pts. 8,636
  5. Avatar for Wiz kid 55. Wiz kid Lv 1 1 pt. 8,632
  6. Avatar for DScott 56. DScott Lv 1 1 pt. 8,615
  7. Avatar for zbp 57. zbp Lv 1 1 pt. 8,565
  8. Avatar for Arne Heessels 58. Arne Heessels Lv 1 1 pt. 8,522
  9. Avatar for royd 59. royd Lv 1 1 pt. 8,441
  10. Avatar for rinze 60. rinze Lv 1 1 pt. 8,417

Comments