Icon representing a puzzle

2305: Revisiting Puzzle 80: Calcium Channel Blocker

Closed since almost 3 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
May 24, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is found in green mamba venom, and blocks the flow of calcium ions that normally depolarize the muscle cell to induce muscle contraction. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,368
  2. Avatar for Go Science 2. Go Science 68 pts. 10,160
  3. Avatar for FamilyBarmettler 3. FamilyBarmettler 44 pts. 10,082
  4. Avatar for Contenders 4. Contenders 27 pts. 10,014
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 16 pts. 9,926
  6. Avatar for Marvin's bunch 6. Marvin's bunch 9 pts. 9,846
  7. Avatar for Australia 7. Australia 5 pts. 9,792
  8. Avatar for Trinity Biology 8. Trinity Biology 3 pts. 8,835
  9. Avatar for AlphaFold 9. AlphaFold 1 pt. 8,802
  10. Avatar for :) 10. :) 1 pt. 8,769

  1. Avatar for wosser1 61. wosser1 Lv 1 1 pt. 8,410
  2. Avatar for NickMihal 62. NickMihal Lv 1 1 pt. 8,384
  3. Avatar for Merf 63. Merf Lv 1 1 pt. 8,347
  4. Avatar for HavocOrder0999 64. HavocOrder0999 Lv 1 1 pt. 8,340
  5. Avatar for rezaefar 65. rezaefar Lv 1 1 pt. 8,335
  6. Avatar for fiendish_ghoul 66. fiendish_ghoul Lv 1 1 pt. 8,224
  7. Avatar for CAN1958 67. CAN1958 Lv 1 1 pt. 8,191
  8. Avatar for Deleted player 68. Deleted player 1 pt. 8,147
  9. Avatar for Pibeagles1 69. Pibeagles1 Lv 1 1 pt. 8,138
  10. Avatar for Grbee 70. Grbee Lv 1 1 pt. 8,111

Comments