Icon representing a puzzle

2305: Revisiting Puzzle 80: Calcium Channel Blocker

Closed since almost 3 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
May 24, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is found in green mamba venom, and blocks the flow of calcium ions that normally depolarize the muscle cell to induce muscle contraction. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,368
  2. Avatar for Go Science 2. Go Science 68 pts. 10,160
  3. Avatar for FamilyBarmettler 3. FamilyBarmettler 44 pts. 10,082
  4. Avatar for Contenders 4. Contenders 27 pts. 10,014
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 16 pts. 9,926
  6. Avatar for Marvin's bunch 6. Marvin's bunch 9 pts. 9,846
  7. Avatar for Australia 7. Australia 5 pts. 9,792
  8. Avatar for Trinity Biology 8. Trinity Biology 3 pts. 8,835
  9. Avatar for AlphaFold 9. AlphaFold 1 pt. 8,802
  10. Avatar for :) 10. :) 1 pt. 8,769

  1. Avatar for U202243292 81. U202243292 Lv 1 1 pt. 7,650
  2. Avatar for brockmcneill 82. brockmcneill Lv 1 1 pt. 7,623
  3. Avatar for PankreasCupang 83. PankreasCupang Lv 1 1 pt. 7,577
  4. Avatar for deathbat_87 84. deathbat_87 Lv 1 1 pt. 7,557
  5. Avatar for Peng 85. Peng Lv 1 1 pt. 5,494
  6. Avatar for cairuoqing 86. cairuoqing Lv 1 1 pt. 3,334
  7. Avatar for phi16 87. phi16 Lv 1 1 pt. 3,334
  8. Avatar for U202243316 88. U202243316 Lv 1 1 pt. 3,334
  9. Avatar for U202241422 89. U202241422 Lv 1 1 pt. 3,334
  10. Avatar for apetrides 90. apetrides Lv 1 1 pt. 3,334

Comments