Placeholder image of a protein
Icon representing a puzzle

2309: Electron Density Reconstruction 42

Closed since almost 3 years ago

Novice Overall Prediction Electron Density

Summary

Created
May 30, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This case has several of the same sequence in it (although visible segments might be different for different copies), and is pretty large, so trim tool may be necessary

Sequence
MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMAISDPMALAKAKEIVASAPVVVFSKSYCPFCVQVKKLFTQLGASFKAIELDTESDGTEIQSALAEWTGQRTVPNVFINGKHIGGCDDTIALNKGGKLVALLTEAGAISGSSSKTTVTPLEHHHHHH

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 63,457
  2. Avatar for :) 12. :) 1 pt. 58,280
  3. Avatar for Team China 13. Team China 1 pt. 54,777
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 53,852
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 53,048
  6. Avatar for Ogre's lab 16. Ogre's lab 1 pt. 10,845
  7. Avatar for Street Smarts 17. Street Smarts 1 pt. 8,357
  1. Avatar for MicElephant 11. MicElephant Lv 1 49 pts. 67,478
  2. Avatar for drjr 12. drjr Lv 1 45 pts. 67,440
  3. Avatar for Bletchley Park 13. Bletchley Park Lv 1 42 pts. 67,339
  4. Avatar for Wanderer09 14. Wanderer09 Lv 1 39 pts. 67,312
  5. Avatar for NinjaGreg 15. NinjaGreg Lv 1 36 pts. 67,162
  6. Avatar for silent gene 16. silent gene Lv 1 33 pts. 67,050
  7. Avatar for fpc 17. fpc Lv 1 30 pts. 66,618
  8. Avatar for alcor29 18. alcor29 Lv 1 28 pts. 66,561
  9. Avatar for Idiotboy 19. Idiotboy Lv 1 25 pts. 66,537
  10. Avatar for AlkiP0Ps 20. AlkiP0Ps Lv 1 23 pts. 66,301

Comments

LociOiling Lv 1

Also, as spotted by the eagle-eyed gmn, this is the second puzzle 2308. Maybe we can call this one 2309?