Placeholder image of a protein
Icon representing a puzzle

2309: Electron Density Reconstruction 42

Closed since almost 3 years ago

Novice Overall Prediction Electron Density

Summary

Created
May 30, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This case has several of the same sequence in it (although visible segments might be different for different copies), and is pretty large, so trim tool may be necessary

Sequence
MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMAISDPMALAKAKEIVASAPVVVFSKSYCPFCVQVKKLFTQLGASFKAIELDTESDGTEIQSALAEWTGQRTVPNVFINGKHIGGCDDTIALNKGGKLVALLTEAGAISGSSSKTTVTPLEHHHHHH

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 67,908
  2. Avatar for Go Science 2. Go Science 73 pts. 67,851
  3. Avatar for Contenders 3. Contenders 52 pts. 67,478
  4. Avatar for Marvin's bunch 4. Marvin's bunch 36 pts. 67,082
  5. Avatar for Australia 5. Australia 24 pts. 66,301
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 65,485
  7. Avatar for VeFold 7. VeFold 10 pts. 65,055
  8. Avatar for AlphaFold 8. AlphaFold 6 pts. 65,055
  9. Avatar for Gargleblasters 9. Gargleblasters 4 pts. 64,891
  10. Avatar for FamilyBarmettler 10. FamilyBarmettler 2 pts. 64,865
  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 67,908
  2. Avatar for Bruno Kestemont 2. Bruno Kestemont Lv 1 94 pts. 67,851
  3. Avatar for Punzi Baker 3 3. Punzi Baker 3 Lv 1 88 pts. 67,801
  4. Avatar for Sandrix72 4. Sandrix72 Lv 1 82 pts. 67,751
  5. Avatar for blazegeek 5. blazegeek Lv 1 76 pts. 67,743
  6. Avatar for LociOiling 6. LociOiling Lv 1 71 pts. 67,697
  7. Avatar for gmn 7. gmn Lv 1 66 pts. 67,689
  8. Avatar for grogar7 8. grogar7 Lv 1 61 pts. 67,500
  9. Avatar for dcrwheeler 9. dcrwheeler Lv 1 57 pts. 67,484
  10. Avatar for phi16 10. phi16 Lv 1 53 pts. 67,484

Comments

LociOiling Lv 1

Also, as spotted by the eagle-eyed gmn, this is the second puzzle 2308. Maybe we can call this one 2309?