Placeholder image of a protein
Icon representing a puzzle

2309: Electron Density Reconstruction 42

Closed since almost 3 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
May 30, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This case has several of the same sequence in it (although visible segments might be different for different copies), and is pretty large, so trim tool may be necessary

Sequence
MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMAISDPMALAKAKEIVASAPVVVFSKSYCPFCVQVKKLFTQLGASFKAIELDTESDGTEIQSALAEWTGQRTVPNVFINGKHIGGCDDTIALNKGGKLVALLTEAGAISGSSSKTTVTPLEHHHHHH

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 63,457
  2. Avatar for :) 12. :) 1 pt. 58,280
  3. Avatar for Team China 13. Team China 1 pt. 54,777
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 53,852
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 53,048
  6. Avatar for Ogre's lab 16. Ogre's lab 1 pt. 10,845
  7. Avatar for Street Smarts 17. Street Smarts 1 pt. 8,357

  1. Avatar for rosie4loop 41. rosie4loop Lv 1 3 pts. 61,102
  2. Avatar for rezaefar 42. rezaefar Lv 1 2 pts. 61,064
  3. Avatar for Arne Heessels 43. Arne Heessels Lv 1 2 pts. 60,833
  4. Avatar for maithra 44. maithra Lv 1 2 pts. 60,760
  5. Avatar for carxo 45. carxo Lv 1 2 pts. 59,766
  6. Avatar for equilibria 47. equilibria Lv 1 1 pt. 58,456
  7. Avatar for Wiz kid 48. Wiz kid Lv 1 1 pt. 58,380
  8. Avatar for machinelves 49. machinelves Lv 1 1 pt. 58,280
  9. Avatar for Merf 50. Merf Lv 1 1 pt. 57,972

Comments


LociOiling Lv 1

Also, as spotted by the eagle-eyed gmn, this is the second puzzle 2308. Maybe we can call this one 2309?