Placeholder image of a protein
Icon representing a puzzle

2309: Electron Density Reconstruction 42

Closed since almost 3 years ago

Novice Overall Prediction Electron Density

Summary

Created
May 30, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This case has several of the same sequence in it (although visible segments might be different for different copies), and is pretty large, so trim tool may be necessary

Sequence
MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMAISDPMALAKAKEIVASAPVVVFSKSYCPFCVQVKKLFTQLGASFKAIELDTESDGTEIQSALAEWTGQRTVPNVFINGKHIGGCDDTIALNKGGKLVALLTEAGAISGSSSKTTVTPLEHHHHHH

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 63,457
  2. Avatar for :) 12. :) 1 pt. 58,280
  3. Avatar for Team China 13. Team China 1 pt. 54,777
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 53,852
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 53,048
  6. Avatar for Ogre's lab 16. Ogre's lab 1 pt. 10,845
  7. Avatar for Street Smarts 17. Street Smarts 1 pt. 8,357
  1. Avatar for mart0258 51. mart0258 Lv 1 1 pt. 57,884
  2. Avatar for abiogenesis 52. abiogenesis Lv 1 1 pt. 57,543
  3. Avatar for hansvandenhof 53. hansvandenhof Lv 1 1 pt. 57,476
  4. Avatar for Mohoernchen 54. Mohoernchen Lv 1 1 pt. 55,726
  5. Avatar for Dr.Sillem 55. Dr.Sillem Lv 1 1 pt. 55,545
  6. Avatar for pizpot 56. pizpot Lv 1 1 pt. 55,435
  7. Avatar for rinze 57. rinze Lv 1 1 pt. 55,274
  8. Avatar for froschi2 58. froschi2 Lv 1 1 pt. 55,223
  9. Avatar for Grbee 59. Grbee Lv 1 1 pt. 55,100
  10. Avatar for Larini 60. Larini Lv 1 1 pt. 55,063

Comments

LociOiling Lv 1

Also, as spotted by the eagle-eyed gmn, this is the second puzzle 2308. Maybe we can call this one 2309?