Placeholder image of a protein
Icon representing a puzzle

2309: Electron Density Reconstruction 42

Closed since almost 3 years ago

Novice Overall Prediction Electron Density

Summary

Created
May 30, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This case has several of the same sequence in it (although visible segments might be different for different copies), and is pretty large, so trim tool may be necessary

Sequence
MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMAISDPMALAKAKEIVASAPVVVFSKSYCPFCVQVKKLFTQLGASFKAIELDTESDGTEIQSALAEWTGQRTVPNVFINGKHIGGCDDTIALNKGGKLVALLTEAGAISGSSSKTTVTPLEHHHHHH

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 63,457
  2. Avatar for :) 12. :) 1 pt. 58,280
  3. Avatar for Team China 13. Team China 1 pt. 54,777
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 53,852
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 53,048
  6. Avatar for Ogre's lab 16. Ogre's lab 1 pt. 10,845
  7. Avatar for Street Smarts 17. Street Smarts 1 pt. 8,357
  1. Avatar for pruneau_44 61. pruneau_44 Lv 1 1 pt. 55,017
  2. Avatar for zo3xiaJonWeinberg 62. zo3xiaJonWeinberg Lv 1 1 pt. 54,777
  3. Avatar for Swapper242 63. Swapper242 Lv 1 1 pt. 54,751
  4. Avatar for PhilipReichel 64. PhilipReichel Lv 1 1 pt. 54,671
  5. Avatar for Just_A_Nerd 65. Just_A_Nerd Lv 1 1 pt. 54,282
  6. Avatar for Deleted player 66. Deleted player 1 pt. 53,922
  7. Avatar for alyssa_d_V2.0 67. alyssa_d_V2.0 Lv 1 1 pt. 53,852
  8. Avatar for Sammy3c2b1a0 68. Sammy3c2b1a0 Lv 1 1 pt. 53,048
  9. Avatar for Quantum9356 69. Quantum9356 Lv 1 1 pt. 51,966
  10. Avatar for BlueEqualsRed 70. BlueEqualsRed Lv 1 1 pt. 51,289

Comments

LociOiling Lv 1

Also, as spotted by the eagle-eyed gmn, this is the second puzzle 2308. Maybe we can call this one 2309?