Placeholder image of a protein
Icon representing a puzzle

2309: Electron Density Reconstruction 42

Closed since almost 3 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
May 30, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This case has several of the same sequence in it (although visible segments might be different for different copies), and is pretty large, so trim tool may be necessary

Sequence
MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMAISDPMALAKAKEIVASAPVVVFSKSYCPFCVQVKKLFTQLGASFKAIELDTESDGTEIQSALAEWTGQRTVPNVFINGKHIGGCDDTIALNKGGKLVALLTEAGAISGSSSKTTVTPLEHHHHHH

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 67,908
  2. Avatar for Go Science 2. Go Science 73 pts. 67,851
  3. Avatar for Contenders 3. Contenders 52 pts. 67,478
  4. Avatar for Marvin's bunch 4. Marvin's bunch 36 pts. 67,082
  5. Avatar for Australia 5. Australia 24 pts. 66,301
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 65,485
  7. Avatar for VeFold 7. VeFold 10 pts. 65,055
  8. Avatar for AlphaFold 8. AlphaFold 6 pts. 65,055
  9. Avatar for Gargleblasters 9. Gargleblasters 4 pts. 64,891
  10. Avatar for FamilyBarmettler 10. FamilyBarmettler 2 pts. 64,865

  1. Avatar for Trajan464 21. Trajan464 Lv 1 21 pts. 66,221
  2. Avatar for BackBuffer 22. BackBuffer Lv 1 19 pts. 65,748
  3. Avatar for Steven Pletsch 23. Steven Pletsch Lv 1 18 pts. 65,555
  4. Avatar for christioanchauvin 24. christioanchauvin Lv 1 16 pts. 65,485
  5. Avatar for guineapig 25. guineapig Lv 1 15 pts. 65,231
  6. Avatar for akaaka 26. akaaka Lv 1 13 pts. 65,220
  7. Avatar for AlphaFold2 27. AlphaFold2 Lv 1 12 pts. 65,055
  8. Avatar for Joanna_H 28. Joanna_H Lv 1 11 pts. 64,891
  9. Avatar for WBarme1234 29. WBarme1234 Lv 1 10 pts. 64,865
  10. Avatar for georg137 30. georg137 Lv 1 9 pts. 64,078

Comments


LociOiling Lv 1

Also, as spotted by the eagle-eyed gmn, this is the second puzzle 2308. Maybe we can call this one 2309?