Placeholder image of a protein
Icon representing a puzzle

2309: Electron Density Reconstruction 42

Closed since almost 3 years ago

Novice Overall Prediction Electron Density

Summary

Created
May 30, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This case has several of the same sequence in it (although visible segments might be different for different copies), and is pretty large, so trim tool may be necessary

Sequence
MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMAISDPMALAKAKEIVASAPVVVFSKSYCPFCVQVKKLFTQLGASFKAIELDTESDGTEIQSALAEWTGQRTVPNVFINGKHIGGCDDTIALNKGGKLVALLTEAGAISGSSSKTTVTPLEHHHHHH

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 67,908
  2. Avatar for Go Science 2. Go Science 73 pts. 67,851
  3. Avatar for Contenders 3. Contenders 52 pts. 67,478
  4. Avatar for Marvin's bunch 4. Marvin's bunch 36 pts. 67,082
  5. Avatar for Australia 5. Australia 24 pts. 66,301
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 65,485
  7. Avatar for VeFold 7. VeFold 10 pts. 65,055
  8. Avatar for AlphaFold 8. AlphaFold 6 pts. 65,055
  9. Avatar for Gargleblasters 9. Gargleblasters 4 pts. 64,891
  10. Avatar for FamilyBarmettler 10. FamilyBarmettler 2 pts. 64,865
  1. Avatar for ShadowTactics 31. ShadowTactics Lv 1 8 pts. 63,457
  2. Avatar for manu8170 32. manu8170 Lv 1 7 pts. 63,175
  3. Avatar for hada 33. hada Lv 1 6 pts. 63,064
  4. Avatar for BootsMcGraw 34. BootsMcGraw Lv 1 6 pts. 62,716
  5. Avatar for RichGuilmain 35. RichGuilmain Lv 1 5 pts. 62,463
  6. Avatar for Flagg65a 36. Flagg65a Lv 1 5 pts. 62,253
  7. Avatar for Altercomp 37. Altercomp Lv 1 4 pts. 62,065
  8. Avatar for Oransche 38. Oransche Lv 1 4 pts. 62,019
  9. Avatar for zbp 39. zbp Lv 1 3 pts. 61,782
  10. Avatar for HavocOrder0999 40. HavocOrder0999 Lv 1 3 pts. 61,135

Comments

LociOiling Lv 1

Also, as spotted by the eagle-eyed gmn, this is the second puzzle 2308. Maybe we can call this one 2309?