Icon representing a puzzle

2308: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since almost 3 years ago

Novice Overall Prediction

Summary

Created
May 31, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 9,903
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 9,799
  3. Avatar for VeFold 13. VeFold 1 pt. 9,768
  4. Avatar for Ogre's lab 14. Ogre's lab 1 pt. 9,722
  5. Avatar for Team China 15. Team China 1 pt. 9,074
  6. Avatar for SHELL 16. SHELL 1 pt. 4,734
  1. Avatar for abskebabs 71. abskebabs Lv 1 1 pt. 9,237
  2. Avatar for Deleted player 72. Deleted player 1 pt. 9,235
  3. Avatar for Just_A_Nerd 73. Just_A_Nerd Lv 1 1 pt. 9,218
  4. Avatar for Sammy3c2b1a0 74. Sammy3c2b1a0 Lv 1 1 pt. 9,093
  5. Avatar for zo3xiaJonWeinberg 75. zo3xiaJonWeinberg Lv 1 1 pt. 9,074
  6. Avatar for Swapper242 76. Swapper242 Lv 1 1 pt. 8,835
  7. Avatar for furi0us 77. furi0us Lv 1 1 pt. 8,442
  8. Avatar for samurai44444444 78. samurai44444444 Lv 1 1 pt. 7,394
  9. Avatar for Lian Lozada 79. Lian Lozada Lv 1 1 pt. 7,318
  10. Avatar for Hanna Hunter 80. Hanna Hunter Lv 1 1 pt. 6,649

Comments