Icon representing a puzzle

2308: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since almost 3 years ago

Novice Overall Prediction

Summary

Created
May 31, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 9,903
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 9,799
  3. Avatar for VeFold 13. VeFold 1 pt. 9,768
  4. Avatar for Ogre's lab 14. Ogre's lab 1 pt. 9,722
  5. Avatar for Team China 15. Team China 1 pt. 9,074
  6. Avatar for SHELL 16. SHELL 1 pt. 4,734
  1. Avatar for Elon 81. Elon Lv 1 1 pt. 4,734
  2. Avatar for luobochitu 82. luobochitu Lv 1 1 pt. 4,734
  3. Avatar for liuhongyan 83. liuhongyan Lv 1 1 pt. 4,734

Comments