Placeholder image of a protein
Icon representing a puzzle

2315: Electron Density Reconstruction 44

Closed since almost 3 years ago

Novice Overall Prediction Electron Density

Summary


Created
June 08, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
NAMYTITDIAPTDAEFIALIAALDAWQETLDLSQLPPQTVIALAIRSPQGEAVGCGAIVLSEEGFGEMKRVYIDPQHRGQQLGEKLLAALEAKARQRDCHTLRLETGIHQHAAIALYTRNGYQTRCAFAPYQPDPLSVFMEKPLF

Top groups


  1. Avatar for Go Science 100 pts. 25,520
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 56 pts. 25,516
  3. Avatar for Marvin's bunch 3. Marvin's bunch 29 pts. 25,431
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 14 pts. 25,424
  5. Avatar for Contenders 5. Contenders 6 pts. 25,414
  6. Avatar for Australia 6. Australia 2 pts. 25,373
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 1 pt. 25,312
  8. Avatar for Gargleblasters 8. Gargleblasters 1 pt. 25,051
  9. Avatar for :) 9. :) 1 pt. 24,461
  10. Avatar for VeFold 10. VeFold 1 pt. 24,192

  1. Avatar for BootsMcGraw 21. BootsMcGraw Lv 1 14 pts. 25,316
  2. Avatar for WBarme1234 22. WBarme1234 Lv 1 12 pts. 25,312
  3. Avatar for phi16 23. phi16 Lv 1 11 pts. 25,299
  4. Avatar for akaaka 24. akaaka Lv 1 9 pts. 25,288
  5. Avatar for fiendish_ghoul 25. fiendish_ghoul Lv 1 8 pts. 25,252
  6. Avatar for jausmh 26. jausmh Lv 1 7 pts. 25,229
  7. Avatar for Steven Pletsch 27. Steven Pletsch Lv 1 6 pts. 25,222
  8. Avatar for Anfinsen_slept_here 28. Anfinsen_slept_here Lv 1 6 pts. 25,153
  9. Avatar for Idiotboy 29. Idiotboy Lv 1 5 pts. 25,149
  10. Avatar for Flagg65a 30. Flagg65a Lv 1 4 pts. 25,094

Comments