Placeholder image of a protein
Icon representing a puzzle

2315: Electron Density Reconstruction 44

Closed since almost 3 years ago

Novice Overall Prediction Electron Density

Summary


Created
June 08, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
NAMYTITDIAPTDAEFIALIAALDAWQETLDLSQLPPQTVIALAIRSPQGEAVGCGAIVLSEEGFGEMKRVYIDPQHRGQQLGEKLLAALEAKARQRDCHTLRLETGIHQHAAIALYTRNGYQTRCAFAPYQPDPLSVFMEKPLF

Top groups


  1. Avatar for Go Science 100 pts. 25,520
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 56 pts. 25,516
  3. Avatar for Marvin's bunch 3. Marvin's bunch 29 pts. 25,431
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 14 pts. 25,424
  5. Avatar for Contenders 5. Contenders 6 pts. 25,414
  6. Avatar for Australia 6. Australia 2 pts. 25,373
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 1 pt. 25,312
  8. Avatar for Gargleblasters 8. Gargleblasters 1 pt. 25,051
  9. Avatar for :) 9. :) 1 pt. 24,461
  10. Avatar for VeFold 10. VeFold 1 pt. 24,192

  1. Avatar for NinjaGreg
    1. NinjaGreg Lv 1
    100 pts. 25,520
  2. Avatar for Sandrix72 2. Sandrix72 Lv 1 92 pts. 25,517
  3. Avatar for LociOiling 3. LociOiling Lv 1 85 pts. 25,516
  4. Avatar for Galaxie 4. Galaxie Lv 1 78 pts. 25,502
  5. Avatar for alcor29 5. alcor29 Lv 1 71 pts. 25,464
  6. Avatar for Bruno Kestemont 6. Bruno Kestemont Lv 1 65 pts. 25,445
  7. Avatar for fpc 7. fpc Lv 1 60 pts. 25,431
  8. Avatar for christioanchauvin 8. christioanchauvin Lv 1 54 pts. 25,424
  9. Avatar for guineapig 9. guineapig Lv 1 49 pts. 25,414
  10. Avatar for Wanderer09 10. Wanderer09 Lv 1 45 pts. 25,408

Comments