Placeholder image of a protein
Icon representing a puzzle

2315: Electron Density Reconstruction 44

Closed since almost 3 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
June 08, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
NAMYTITDIAPTDAEFIALIAALDAWQETLDLSQLPPQTVIALAIRSPQGEAVGCGAIVLSEEGFGEMKRVYIDPQHRGQQLGEKLLAALEAKARQRDCHTLRLETGIHQHAAIALYTRNGYQTRCAFAPYQPDPLSVFMEKPLF

Top groups


  1. Avatar for Go Science 100 pts. 25,520
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 56 pts. 25,516
  3. Avatar for Marvin's bunch 3. Marvin's bunch 29 pts. 25,431
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 14 pts. 25,424
  5. Avatar for Contenders 5. Contenders 6 pts. 25,414
  6. Avatar for Australia 6. Australia 2 pts. 25,373
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 1 pt. 25,312
  8. Avatar for Gargleblasters 8. Gargleblasters 1 pt. 25,051
  9. Avatar for :) 9. :) 1 pt. 24,461
  10. Avatar for VeFold 10. VeFold 1 pt. 24,192

  1. Avatar for Merf 41. Merf Lv 1 1 pt. 24,575
  2. Avatar for rosie4loop 42. rosie4loop Lv 1 1 pt. 24,564
  3. Avatar for machinelves 43. machinelves Lv 1 1 pt. 24,461
  4. Avatar for abiogenesis 44. abiogenesis Lv 1 1 pt. 24,458
  5. Avatar for wosser1 45. wosser1 Lv 1 1 pt. 24,304
  6. Avatar for Arne Heessels 46. Arne Heessels Lv 1 1 pt. 24,286
  7. Avatar for drp6 47. drp6 Lv 1 1 pt. 24,230
  8. Avatar for hansvandenhof 48. hansvandenhof Lv 1 1 pt. 24,216
  9. Avatar for karl07 49. karl07 Lv 1 1 pt. 24,201
  10. Avatar for carxo 50. carxo Lv 1 1 pt. 24,192

Comments