Icon representing a puzzle

2311: Revisiting Puzzle 82: Cytotoxin

Closed since almost 3 years ago

Novice Overall Prediction

Summary

Created
June 09, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups

  1. Avatar for VeFold 11. VeFold 1 pt. 8,681
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 8,295
  3. Avatar for Russian team 13. Russian team 1 pt. 8,121
  1. Avatar for Alvinek47 91. Alvinek47 Lv 1 1 pt. 7,296
  2. Avatar for TaralliPugliesi69 92. TaralliPugliesi69 Lv 1 1 pt. 7,203
  3. Avatar for lconor 93. lconor Lv 1 1 pt. 6,903
  4. Avatar for umekoo 94. umekoo Lv 1 1 pt. 3,556

Comments