Icon representing a puzzle

2311: Revisiting Puzzle 82: Cytotoxin

Closed since almost 3 years ago

Novice Overall Prediction

Summary


Created
June 09, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups


  1. Avatar for VeFold 11. VeFold 1 pt. 8,681
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 8,295
  3. Avatar for Russian team 13. Russian team 1 pt. 8,121

  1. Avatar for Joanna_H 11. Joanna_H Lv 1 57 pts. 10,124
  2. Avatar for WBarme1234 12. WBarme1234 Lv 1 54 pts. 10,121
  3. Avatar for BootsMcGraw 13. BootsMcGraw Lv 1 51 pts. 10,089
  4. Avatar for BackBuffer 14. BackBuffer Lv 1 48 pts. 10,088
  5. Avatar for Punzi Baker 3 15. Punzi Baker 3 Lv 1 45 pts. 10,035
  6. Avatar for guineapig 16. guineapig Lv 1 42 pts. 10,006
  7. Avatar for roarshock 17. roarshock Lv 1 39 pts. 10,004
  8. Avatar for MicElephant 18. MicElephant Lv 1 37 pts. 9,990
  9. Avatar for alcor29 19. alcor29 Lv 1 35 pts. 9,990
  10. Avatar for maithra 20. maithra Lv 1 32 pts. 9,989

Comments