Icon representing a puzzle

2311: Revisiting Puzzle 82: Cytotoxin

Closed since almost 3 years ago

Novice Overall Prediction

Summary

Created
June 09, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups

  1. Avatar for VeFold 11. VeFold 1 pt. 8,681
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 8,295
  3. Avatar for Russian team 13. Russian team 1 pt. 8,121
  1. Avatar for hada 41. hada Lv 1 7 pts. 8,909
  2. Avatar for ProfVince 42. ProfVince Lv 1 6 pts. 8,894
  3. Avatar for HavocOrder0999 43. HavocOrder0999 Lv 1 5 pts. 8,889
  4. Avatar for Dr.Sillem 44. Dr.Sillem Lv 1 5 pts. 8,820
  5. Avatar for Arne Heessels 45. Arne Heessels Lv 1 5 pts. 8,799
  6. Avatar for phi16 46. phi16 Lv 1 4 pts. 8,792
  7. Avatar for DScott 47. DScott Lv 1 4 pts. 8,790
  8. Avatar for alyssa_d_V2.0 48. alyssa_d_V2.0 Lv 1 3 pts. 8,730
  9. Avatar for XeleX 49. XeleX Lv 1 3 pts. 8,703
  10. Avatar for carxo 50. carxo Lv 1 3 pts. 8,681

Comments