Icon representing a puzzle

2311: Revisiting Puzzle 82: Cytotoxin

Closed since almost 3 years ago

Novice Overall Prediction

Summary


Created
June 09, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups


  1. Avatar for VeFold 11. VeFold 1 pt. 8,681
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 8,295
  3. Avatar for Russian team 13. Russian team 1 pt. 8,121

  1. Avatar for Steven Pletsch 51. Steven Pletsch Lv 1 3 pts. 8,676
  2. Avatar for Trajan464 52. Trajan464 Lv 1 2 pts. 8,665
  3. Avatar for abiogenesis 53. abiogenesis Lv 1 2 pts. 8,664
  4. Avatar for pfirth 54. pfirth Lv 1 2 pts. 8,612
  5. Avatar for lisarocca 55. lisarocca Lv 1 2 pts. 8,596
  6. Avatar for Alistair69 56. Alistair69 Lv 1 2 pts. 8,592
  7. Avatar for wosser1 57. wosser1 Lv 1 1 pt. 8,509
  8. Avatar for frostschutz 58. frostschutz Lv 1 1 pt. 8,451
  9. Avatar for jausmh 59. jausmh Lv 1 1 pt. 8,411
  10. Avatar for AlphaFold2 60. AlphaFold2 Lv 1 1 pt. 8,295

Comments