Icon representing a puzzle

2311: Revisiting Puzzle 82: Cytotoxin

Closed since almost 3 years ago

Novice Overall Prediction

Summary


Created
June 09, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups


  1. Avatar for VeFold 11. VeFold 1 pt. 8,681
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 8,295
  3. Avatar for Russian team 13. Russian team 1 pt. 8,121

  1. Avatar for Deleted player 61. Deleted player 1 pt. 8,286
  2. Avatar for i tre foldettieri 62. i tre foldettieri Lv 1 1 pt. 8,282
  3. Avatar for thewigglemaster89 63. thewigglemaster89 Lv 1 1 pt. 8,210
  4. Avatar for chyenutis 64. chyenutis Lv 1 1 pt. 8,182
  5. Avatar for ComputerMage 65. ComputerMage Lv 1 1 pt. 8,121
  6. Avatar for cat 66. cat Lv 1 1 pt. 8,105
  7. Avatar for mart0258 67. mart0258 Lv 1 1 pt. 8,087
  8. Avatar for pruneau_44 68. pruneau_44 Lv 1 1 pt. 8,032
  9. Avatar for Mohoernchen 69. Mohoernchen Lv 1 1 pt. 7,989
  10. Avatar for AE 70. AE Lv 1 1 pt. 7,989

Comments