Icon representing a puzzle

2311: Revisiting Puzzle 82: Cytotoxin

Closed since over 2 years ago

Novice Overall Prediction

Summary


Created
June 09, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,419
  2. Avatar for Go Science 2. Go Science 65 pts. 10,310
  3. Avatar for Contenders 3. Contenders 41 pts. 10,151
  4. Avatar for Gargleblasters 4. Gargleblasters 24 pts. 10,124
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 14 pts. 10,121
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 7 pts. 9,975
  7. Avatar for Australia 7. Australia 4 pts. 9,836
  8. Avatar for Marvin's bunch 8. Marvin's bunch 2 pts. 9,785
  9. Avatar for BOINC@Poland 9. BOINC@Poland 1 pt. 9,120
  10. Avatar for Trinity Biology 10. Trinity Biology 1 pt. 8,730

  1. Avatar for Fabio 71. Fabio Lv 1 1 pt. 7,956
  2. Avatar for chaperone 72. chaperone Lv 1 1 pt. 7,952
  3. Avatar for FilGC 73. FilGC Lv 1 1 pt. 7,938
  4. Avatar for giuliacrisci 74. giuliacrisci Lv 1 1 pt. 7,937
  5. Avatar for rinze 75. rinze Lv 1 1 pt. 7,925
  6. Avatar for BlueEqualsRed 76. BlueEqualsRed Lv 1 1 pt. 7,921
  7. Avatar for GAF 77. GAF Lv 1 1 pt. 7,909
  8. Avatar for Shiran 78. Shiran Lv 1 1 pt. 7,852
  9. Avatar for davitzeiro42 80. davitzeiro42 Lv 1 1 pt. 7,826

Comments