Icon representing a puzzle

2311: Revisiting Puzzle 82: Cytotoxin

Closed since almost 3 years ago

Novice Overall Prediction

Summary

Created
June 09, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,419
  2. Avatar for Go Science 2. Go Science 65 pts. 10,310
  3. Avatar for Contenders 3. Contenders 41 pts. 10,151
  4. Avatar for Gargleblasters 4. Gargleblasters 24 pts. 10,124
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 14 pts. 10,121
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 7 pts. 9,975
  7. Avatar for Australia 7. Australia 4 pts. 9,836
  8. Avatar for Marvin's bunch 8. Marvin's bunch 2 pts. 9,785
  9. Avatar for BOINC@Poland 9. BOINC@Poland 1 pt. 9,120
  10. Avatar for Trinity Biology 10. Trinity Biology 1 pt. 8,730
  1. Avatar for EQUIPE 81. EQUIPE Lv 1 1 pt. 7,808
  2. Avatar for Tonzi 82. Tonzi Lv 1 1 pt. 7,775
  3. Avatar for Jaydon 83. Jaydon Lv 1 1 pt. 7,769
  4. Avatar for Tetrominous 84. Tetrominous Lv 1 1 pt. 7,715
  5. Avatar for Swapper242 85. Swapper242 Lv 1 1 pt. 7,687
  6. Avatar for furi0us 86. furi0us Lv 1 1 pt. 7,647
  7. Avatar for apetrides 87. apetrides Lv 1 1 pt. 7,619
  8. Avatar for agautieri 88. agautieri Lv 1 1 pt. 7,534
  9. Avatar for AtomicPuttyRien 89. AtomicPuttyRien Lv 1 1 pt. 7,443
  10. Avatar for hansvandenhof 90. hansvandenhof Lv 1 1 pt. 7,367

Comments