Icon representing a puzzle

2314: Revisiting Puzzle 83: Cardiotoxin

Closed since almost 3 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
June 09, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 8,494

  1. Avatar for WBarme1234 21. WBarme1234 Lv 1 20 pts. 9,925
  2. Avatar for jausmh 22. jausmh Lv 1 18 pts. 9,902
  3. Avatar for Idiotboy 23. Idiotboy Lv 1 17 pts. 9,894
  4. Avatar for Wanderer09 24. Wanderer09 Lv 1 15 pts. 9,857
  5. Avatar for georg137 25. georg137 Lv 1 14 pts. 9,854
  6. Avatar for Joanna_H 26. Joanna_H Lv 1 12 pts. 9,849
  7. Avatar for AlkiP0Ps 27. AlkiP0Ps Lv 1 11 pts. 9,831
  8. Avatar for akaaka 28. akaaka Lv 1 10 pts. 9,828
  9. Avatar for heather-1 29. heather-1 Lv 1 9 pts. 9,827
  10. Avatar for Hillbillie 30. Hillbillie Lv 1 8 pts. 9,786

Comments