Icon representing a puzzle

2314: Revisiting Puzzle 83: Cardiotoxin

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
June 09, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,322
  2. Avatar for Go Science 2. Go Science 60 pts. 10,292
  3. Avatar for Contenders 3. Contenders 33 pts. 10,238
  4. Avatar for Marvin's bunch 4. Marvin's bunch 17 pts. 10,105
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 8 pts. 9,929
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 4 pts. 9,925
  7. Avatar for Gargleblasters 7. Gargleblasters 2 pts. 9,849
  8. Avatar for Australia 8. Australia 1 pt. 9,831
  9. Avatar for AlphaFold 9. AlphaFold 1 pt. 8,797
  10. Avatar for VeFold 10. VeFold 1 pt. 8,667
  1. Avatar for WBarme1234 21. WBarme1234 Lv 1 20 pts. 9,925
  2. Avatar for jausmh 22. jausmh Lv 1 18 pts. 9,902
  3. Avatar for Idiotboy 23. Idiotboy Lv 1 17 pts. 9,894
  4. Avatar for Wanderer09 24. Wanderer09 Lv 1 15 pts. 9,857
  5. Avatar for georg137 25. georg137 Lv 1 14 pts. 9,854
  6. Avatar for Joanna_H 26. Joanna_H Lv 1 12 pts. 9,849
  7. Avatar for AlkiP0Ps 27. AlkiP0Ps Lv 1 11 pts. 9,831
  8. Avatar for akaaka 28. akaaka Lv 1 10 pts. 9,828
  9. Avatar for heather-1 29. heather-1 Lv 1 9 pts. 9,827
  10. Avatar for Hillbillie 30. Hillbillie Lv 1 8 pts. 9,786

Comments