Icon representing a puzzle

2314: Revisiting Puzzle 83: Cardiotoxin

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
June 09, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,322
  2. Avatar for Go Science 2. Go Science 60 pts. 10,292
  3. Avatar for Contenders 3. Contenders 33 pts. 10,238
  4. Avatar for Marvin's bunch 4. Marvin's bunch 17 pts. 10,105
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 8 pts. 9,929
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 4 pts. 9,925
  7. Avatar for Gargleblasters 7. Gargleblasters 2 pts. 9,849
  8. Avatar for Australia 8. Australia 1 pt. 9,831
  9. Avatar for AlphaFold 9. AlphaFold 1 pt. 8,797
  10. Avatar for VeFold 10. VeFold 1 pt. 8,667
  1. Avatar for Flagg65a 31. Flagg65a Lv 1 7 pts. 9,648
  2. Avatar for ProfVince 32. ProfVince Lv 1 6 pts. 9,630
  3. Avatar for phi16 33. phi16 Lv 1 6 pts. 9,624
  4. Avatar for alcor29 34. alcor29 Lv 1 5 pts. 9,619
  5. Avatar for rosie4loop 35. rosie4loop Lv 1 5 pts. 9,599
  6. Avatar for fiendish_ghoul 36. fiendish_ghoul Lv 1 4 pts. 9,447
  7. Avatar for Oransche 37. Oransche Lv 1 4 pts. 9,394
  8. Avatar for RichGuilmain 38. RichGuilmain Lv 1 3 pts. 9,394
  9. Avatar for hansvandenhof 39. hansvandenhof Lv 1 3 pts. 9,367
  10. Avatar for Greg60 40. Greg60 Lv 1 3 pts. 9,233

Comments