Icon representing a puzzle

2317: Revisiting Puzzle 84: Giant Anemone

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
June 09, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups

  1. Avatar for VeFold 11. VeFold 1 pt. 8,612
  2. Avatar for :) 12. :) 1 pt. 8,325
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 8,323
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 8,148
  1. Avatar for Larini 51. Larini Lv 1 1 pt. 8,409
  2. Avatar for Merf 52. Merf Lv 1 1 pt. 8,385
  3. Avatar for jakeanderson 53. jakeanderson Lv 1 1 pt. 8,364
  4. Avatar for DScott 54. DScott Lv 1 1 pt. 8,339
  5. Avatar for rezaefar 55. rezaefar Lv 1 1 pt. 8,336
  6. Avatar for RichGuilmain 56. RichGuilmain Lv 1 1 pt. 8,327
  7. Avatar for machinelves 57. machinelves Lv 1 1 pt. 8,325
  8. Avatar for Savas 58. Savas Lv 1 1 pt. 8,323
  9. Avatar for Greg60 59. Greg60 Lv 1 1 pt. 8,317
  10. Avatar for Deleted player 60. Deleted player 1 pt. 8,265

Comments