Icon representing a puzzle

2317: Revisiting Puzzle 84: Giant Anemone

Closed since almost 3 years ago

Novice Overall Prediction

Summary


Created
June 09, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,885
  2. Avatar for Go Science 2. Go Science 68 pts. 9,849
  3. Avatar for Contenders 3. Contenders 44 pts. 9,794
  4. Avatar for Gargleblasters 4. Gargleblasters 27 pts. 9,708
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 16 pts. 9,629
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 9 pts. 9,553
  7. Avatar for Marvin's bunch 7. Marvin's bunch 5 pts. 9,496
  8. Avatar for Australia 8. Australia 3 pts. 9,364
  9. Avatar for BOINC@Poland 9. BOINC@Poland 1 pt. 9,000
  10. Avatar for AlphaFold 10. AlphaFold 1 pt. 8,645

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 9,882
  2. Avatar for dcrwheeler 2. dcrwheeler Lv 1 94 pts. 9,871
  3. Avatar for Sandrix72 3. Sandrix72 Lv 1 88 pts. 9,849
  4. Avatar for silent gene 4. silent gene Lv 1 82 pts. 9,816
  5. Avatar for NinjaGreg 5. NinjaGreg Lv 1 76 pts. 9,811
  6. Avatar for blazegeek 6. blazegeek Lv 1 71 pts. 9,807
  7. Avatar for MicElephant 7. MicElephant Lv 1 66 pts. 9,794
  8. Avatar for Bruno Kestemont 8. Bruno Kestemont Lv 1 61 pts. 9,744
  9. Avatar for phi16 9. phi16 Lv 1 56 pts. 9,741
  10. Avatar for Bletchley Park 10. Bletchley Park Lv 1 52 pts. 9,723

Comments