Icon representing a puzzle

2317: Revisiting Puzzle 84: Giant Anemone

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
June 09, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups

  1. Avatar for VeFold 11. VeFold 1 pt. 8,612
  2. Avatar for :) 12. :) 1 pt. 8,325
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 8,323
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 8,148
  1. Avatar for apetrides 61. apetrides Lv 1 1 pt. 8,214
  2. Avatar for rinze 62. rinze Lv 1 1 pt. 8,186
  3. Avatar for dahast.de 63. dahast.de Lv 1 1 pt. 8,148
  4. Avatar for ivalnic123 64. ivalnic123 Lv 1 1 pt. 8,131
  5. Avatar for drp6 65. drp6 Lv 1 1 pt. 8,117
  6. Avatar for ProfVince 66. ProfVince Lv 1 1 pt. 7,947
  7. Avatar for frostschutz 67. frostschutz Lv 1 1 pt. 7,920
  8. Avatar for Valle2002 68. Valle2002 Lv 1 1 pt. 7,747
  9. Avatar for Mohoernchen 69. Mohoernchen Lv 1 1 pt. 7,705
  10. Avatar for pruneau_44 70. pruneau_44 Lv 1 1 pt. 7,439

Comments