Icon representing a puzzle

2317: Revisiting Puzzle 84: Giant Anemone

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
June 09, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups

  1. Avatar for VeFold 11. VeFold 1 pt. 8,612
  2. Avatar for :) 12. :) 1 pt. 8,325
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 8,323
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 8,148
  1. Avatar for furi0us 71. furi0us Lv 1 1 pt. 7,332
  2. Avatar for bussei 72. bussei Lv 1 1 pt. 6,623
  3. Avatar for Rocky Roccoco 73. Rocky Roccoco Lv 1 1 pt. 3,378
  4. Avatar for ZeroLeak7 74. ZeroLeak7 Lv 1 1 pt. 3,378

Comments