Icon representing a puzzle

2317: Revisiting Puzzle 84: Giant Anemone

Closed since almost 3 years ago

Novice Overall Prediction

Summary


Created
June 09, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,885
  2. Avatar for Go Science 2. Go Science 68 pts. 9,849
  3. Avatar for Contenders 3. Contenders 44 pts. 9,794
  4. Avatar for Gargleblasters 4. Gargleblasters 27 pts. 9,708
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 16 pts. 9,629
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 9 pts. 9,553
  7. Avatar for Marvin's bunch 7. Marvin's bunch 5 pts. 9,496
  8. Avatar for Australia 8. Australia 3 pts. 9,364
  9. Avatar for BOINC@Poland 9. BOINC@Poland 1 pt. 9,000
  10. Avatar for AlphaFold 10. AlphaFold 1 pt. 8,645

  1. Avatar for BackBuffer 11. BackBuffer Lv 1 48 pts. 9,716
  2. Avatar for Joanna_H 12. Joanna_H Lv 1 45 pts. 9,708
  3. Avatar for gmn 13. gmn Lv 1 41 pts. 9,702
  4. Avatar for grogar7 14. grogar7 Lv 1 38 pts. 9,692
  5. Avatar for BootsMcGraw 15. BootsMcGraw Lv 1 35 pts. 9,642
  6. Avatar for WBarme1234 16. WBarme1234 Lv 1 32 pts. 9,629
  7. Avatar for akaaka 17. akaaka Lv 1 30 pts. 9,622
  8. Avatar for Galaxie 18. Galaxie Lv 1 27 pts. 9,615
  9. Avatar for Punzi Baker 3 19. Punzi Baker 3 Lv 1 25 pts. 9,573
  10. Avatar for Wanderer09 20. Wanderer09 Lv 1 23 pts. 9,555

Comments