Icon representing a puzzle

2317: Revisiting Puzzle 84: Giant Anemone

Closed since almost 3 years ago

Novice Overall Prediction

Summary


Created
June 09, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,885
  2. Avatar for Go Science 2. Go Science 68 pts. 9,849
  3. Avatar for Contenders 3. Contenders 44 pts. 9,794
  4. Avatar for Gargleblasters 4. Gargleblasters 27 pts. 9,708
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 16 pts. 9,629
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 9 pts. 9,553
  7. Avatar for Marvin's bunch 7. Marvin's bunch 5 pts. 9,496
  8. Avatar for Australia 8. Australia 3 pts. 9,364
  9. Avatar for BOINC@Poland 9. BOINC@Poland 1 pt. 9,000
  10. Avatar for AlphaFold 10. AlphaFold 1 pt. 8,645

  1. Avatar for Steven Pletsch 41. Steven Pletsch Lv 1 2 pts. 8,674
  2. Avatar for zbp 42. zbp Lv 1 2 pts. 8,672
  3. Avatar for CDSoffice 43. CDSoffice Lv 1 2 pts. 8,650
  4. Avatar for AlphaFold2 44. AlphaFold2 Lv 1 2 pts. 8,645
  5. Avatar for carxo 45. carxo Lv 1 1 pt. 8,612
  6. Avatar for jausmh 46. jausmh Lv 1 1 pt. 8,599
  7. Avatar for pizpot 47. pizpot Lv 1 1 pt. 8,576
  8. Avatar for Dr.Sillem 48. Dr.Sillem Lv 1 1 pt. 8,552
  9. Avatar for abiogenesis 49. abiogenesis Lv 1 1 pt. 8,548
  10. Avatar for Trajan464 50. Trajan464 Lv 1 1 pt. 8,534

Comments