Icon representing a puzzle

2317: Revisiting Puzzle 84: Giant Anemone

Closed since almost 3 years ago

Novice Overall Prediction

Summary


Created
June 09, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,885
  2. Avatar for Go Science 2. Go Science 68 pts. 9,849
  3. Avatar for Contenders 3. Contenders 44 pts. 9,794
  4. Avatar for Gargleblasters 4. Gargleblasters 27 pts. 9,708
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 16 pts. 9,629
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 9 pts. 9,553
  7. Avatar for Marvin's bunch 7. Marvin's bunch 5 pts. 9,496
  8. Avatar for Australia 8. Australia 3 pts. 9,364
  9. Avatar for BOINC@Poland 9. BOINC@Poland 1 pt. 9,000
  10. Avatar for AlphaFold 10. AlphaFold 1 pt. 8,645

  1. Avatar for Larini 51. Larini Lv 1 1 pt. 8,409
  2. Avatar for Merf 52. Merf Lv 1 1 pt. 8,385
  3. Avatar for jakeanderson 53. jakeanderson Lv 1 1 pt. 8,364
  4. Avatar for DScott 54. DScott Lv 1 1 pt. 8,339
  5. Avatar for rezaefar 55. rezaefar Lv 1 1 pt. 8,336
  6. Avatar for RichGuilmain 56. RichGuilmain Lv 1 1 pt. 8,327
  7. Avatar for machinelves 57. machinelves Lv 1 1 pt. 8,325
  8. Avatar for Savas 58. Savas Lv 1 1 pt. 8,323
  9. Avatar for Greg60 59. Greg60 Lv 1 1 pt. 8,317
  10. Avatar for Deleted player 60. Deleted player 1 pt. 8,265

Comments