Icon representing a puzzle

2317: Revisiting Puzzle 84: Giant Anemone

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
June 09, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,885
  2. Avatar for Go Science 2. Go Science 68 pts. 9,849
  3. Avatar for Contenders 3. Contenders 44 pts. 9,794
  4. Avatar for Gargleblasters 4. Gargleblasters 27 pts. 9,708
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 16 pts. 9,629
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 9 pts. 9,553
  7. Avatar for Marvin's bunch 7. Marvin's bunch 5 pts. 9,496
  8. Avatar for Australia 8. Australia 3 pts. 9,364
  9. Avatar for BOINC@Poland 9. BOINC@Poland 1 pt. 9,000
  10. Avatar for AlphaFold 10. AlphaFold 1 pt. 8,645
  1. Avatar for christioanchauvin 21. christioanchauvin Lv 1 21 pts. 9,553
  2. Avatar for guineapig 22. guineapig Lv 1 19 pts. 9,534
  3. Avatar for georg137 23. georg137 Lv 1 17 pts. 9,512
  4. Avatar for g_b 24. g_b Lv 1 16 pts. 9,508
  5. Avatar for fpc 25. fpc Lv 1 14 pts. 9,496
  6. Avatar for Anfinsen_slept_here 26. Anfinsen_slept_here Lv 1 13 pts. 9,466
  7. Avatar for Idiotboy 27. Idiotboy Lv 1 12 pts. 9,418
  8. Avatar for maithra 28. maithra Lv 1 10 pts. 9,409
  9. Avatar for Hillbillie 29. Hillbillie Lv 1 9 pts. 9,394
  10. Avatar for AlkiP0Ps 30. AlkiP0Ps Lv 1 8 pts. 9,364

Comments